SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000390667 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000390667
Domain Number 1 Region: 39-408
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.37e-63
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000012
Further Details:      
 
Domain Number 2 Region: 385-501
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 4.64e-44
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000390667
Sequence length 509
Comment DLD (Homo_sapiens) dihydrolipoamide dehydrogenase
Sequence
MQSWSRVYCSLAKRGQFNRISHGLQGVSAVPLRTYADQSIDADVTVIGSGPGGYVAAIKA
AQLGFKTVCIEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGKDFTSRGIEMSEVRLNL
EKMMEQKSNAVKALTGGIAHLFKQNKVVHINGYGKITGKNQVTATKAEGSTQVIDAKNIL
IATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVT
AVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNTKVTGATKRSDGKIDVSIEAASGGK
AEVITCDVLLVCIGRRPFTQNLGLEELGIELDPRGRIPVNSRFQTKVPNIYAIGDVVAGP
MLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGK
FPFAANSRAKTNADTDGMVKIIGQKATDRVLGAHILGPGAGEMVNEAALALEYGASCEDI
ARVCHAHPTLSEAFREANLAASFGKAINF
Download sequence
Identical sequences G5C2C6
HGL_H00000390667 XP_004839705.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]