SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000391803 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000391803
Domain Number 1 Region: 306-373
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.7e-16
Family HLH, helix-loop-helix DNA-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000391803
Sequence length 525
Comment MITF (Homo_sapiens) microphthalmia-associated transcription factor
Sequence
MQSESGIVPDFEVGEEFHEEPKTYYELKSQPLKSRSAEHPGASKPPISSSSMTSRILLRQ
QLMREQMQEQERREQQQKLQAAQFMQQRVPVSQTPAINVSVPTTLPSATQVPMEVLKVQT
HLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNSP
MAMLTLNSNCDKEGFYKFEEQNRAESECPSMNTHSRASCMQMDDVIDDIISLESSYNEEI
LGLMDPALQMANTLPISGNLIDLYSNQGLPPSGLTISNSCPANLPNIKRELTACIFPTES
EARALAKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDYI
RKLQREQQRAKELENRQKKLEHANRHLLLRIQELEMQARAHGLSLIPSTGLCSADLVNRI
IKQEPVLENCSQDILQQHPDLSCTTTLDLTDGTISFNSSLGTGPESSPAYSVPMKMASKL
EDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHAC
Download sequence
Identical sequences G5AVQ1
XP_004854247.1.39548 HGL_H00000391803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]