SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000392807 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000392807
Domain Number 1 Region: 33-159
Classification Level Classification E-value
Superfamily Lysozyme-like 2.9e-48
Family C-type lysozyme 0.0000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000392807
Sequence length 160
Comment SPACA3 (Homo_sapiens) sperm acrosome associated 3
Sequence
MEARRSWTPRSWLCPPVMMLLVLTSLLSSSEAKVYSRCELAKVLRDFGLDGYRGYSLADW
VCLAYFTSGFNTGAVGHEADGSTNNGIFQINSRKWCKNLTPDSSNRCQVYCSDLLNPNLK
VTVICAMKIAQEPQGLGNWEAWRHHCQGKELSYWVDGCDF
Download sequence
Identical sequences G5BIN8
XP_004870667.1.39548 XP_004870668.1.39548 XP_004870669.1.39548 HGL_H00000392807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]