SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000392892 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000392892
Domain Number 1 Region: 2-33
Classification Level Classification E-value
Superfamily SAP domain 0.000000476
Family SAP domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000392892
Sequence length 188
Comment SARNP (Homo_sapiens) SAP domain containing ribonucleoprotein
Sequence
QLAELKQECLARGLETKGIKQDLINRLQAYLEEHAEEEANEEDVLGDETEEEETKPIELP
VKEEEPPEKTVDMAAEKKVVKITSEMPQTERMQKRAERFNVPVSLESKKAARAARFGISS
VPTKGLSSDTKPMVNLDKLKERAQRFGLNVSSISRKSEDDEKLKKRKERFGIVTSSAGTG
TTEDTEVK
Download sequence
Identical sequences G5BBA3
HGL_H00000392892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]