SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000393154 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000393154
Domain Number 1 Region: 70-127
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000000196
Family F-box domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000393154
Sequence length 249
Comment FBXO15 (Homo_sapiens) F-box protein 15
Sequence
MATGRGPPPWHRLQGLREPREPLRGGGAAWGTTGAAAGRTGASRFRKGRGVKFGAGDTAL
RQYARRGQHFEKSPSNCSVYLDRMPSEILLKIFSYLDAVSLLCVGCVNRRFYHLANDKPR
WYSLIAQYDLSQLTESTMIGCDRIIRIFSLSPGLVVGLWKSCSFMDVTLLDEHRKPFWCL
SSAVYMRPAVCPSDGPHFLGQTYYIDYKDVEGRVHAELVWIEETEEYFIVSLVLYLSVAK
INHWFGTKY
Download sequence
Identical sequences G5BAQ4
HGL_H00000393154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]