SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000393788 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000393788
Domain Number 1 Region: 270-329
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000314
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Weak hits

Sequence:  HGL_H00000393788
Domain Number - Region: 6-50
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00706
Family Myosin rod fragments 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000393788
Sequence length 496
Comment SOHLH2 (Homo_sapiens) spermatogenesis and oogenesis specific basic helix-loop-helix 2
Sequence
QESLNTLLKQLEKEKRSLESQVKDYALRLEQESKVYQRTNKERRTYLAEMSRGSGSHQVS
KRQQIEQLPRMKENLVKAVYCKSRTNPLQEKIDLLLVGDVTVCYLADDIQKFFPSSAEVT
ITISDVKKAATLLDDCTFDIVFLKITSFLTAEELEAIKSIRFGMKKNTDLLFIFIIPEKF
KGCISGRGADVTLTEPLTREKLSIVVKYWKMYFSNTVKKENSARPEEHGSPLPSSYSEHL
GYFSTDLFTCSESLKNDIGLEFKVPLSEFEKSKQISFLHSSKEKLRRERIKYCCEQLRIL
LPYIKGRKNDSASVLEATVDYVKYVREKIPPAAMRQITEALQNNRRFCKKQMPIQLSLPC
TVKAERENNVLASTYSPVRGIQFLANKCLNVYSLPAAGAPLDEAVRGQSSSTSESAIGDL
YKARISSAALSLNSFHAVRCYSKVIPSFDVAAVTNQNVPIHLPSAVPKVSKFLPQHCNSV
LDQTCATHPNCPVSLW
Download sequence
Identical sequences G5B3M6
HGL_H00000393788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]