SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000396995 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000396995
Domain Number 1 Region: 93-247
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3e-38
Family Poly(A) polymerase, PAP, N-terminal domain 0.021
Further Details:      
 
Domain Number 2 Region: 235-374
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 4.19e-37
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000396995
Sequence length 599
Comment PAPD5 (Homo_sapiens) PAP associated domain containing 5
Sequence
QPAAWARRTASGPPATPTPLAAPAPRSSAAAVPAEPADPASGSSNKRKRDNKASTYGLNY
SLLQPSGVRAAGGGRAEGGGGVYSGTPWKRRNYNQGVVGLHEEISDFYEYMSPRPEEEKM
RMEVVSRIESVIKELWPSADVQIFGSFKTGLYLPTSDIDLVVFGKWENLPLWTLEEALRK
HKVADEDSVKVLDKATVPIIKLTDSFTEVKVDISFNVQNGVRAADLIKDFTKKYPVLPYL
VLVLKQFLLQRDLNEVFTGGIGSYSLFLMAVSFLQLHPREDACIPNTNYGVLLIEFFELY
GRHFNYLKTGIRIKDGGSYVAKDEVQKNMLDGYRPSMLYIEDPLQPGNDVGRSSYGAMQV
KQAFDYAYVVLSHAVSPIAKYYPNNETESILGRIIRVTDEVATYRDWISKQWGLQNRPEP
SCNGNGVTLIVDTQQLDKCNNNLSEENEALGKCRSKTSESLSKHSSNSSSGPVSSSSATQ
SSSSDVDSDATPCKTPKQLLCRPSTGNRVGSQDVSLESSQTIGKMQSTQTTNTPNSTNKS
QHGSARLFRSSSKGFQGTTQTSHGSLMTNKQHQGKSNNQYYHGKKRKHKRDTPLSDLCR
Download sequence
Identical sequences G5C246
HGL_H00000396995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]