SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000398597 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000398597
Domain Number 1 Region: 88-161
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.15e-19
Family Ribonuclease PH domain 2-like 0.0000146
Further Details:      
 
Domain Number 2 Region: 31-74
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000000000607
Family Ribonuclease PH domain 1-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000398597
Sequence length 167
Comment EXOSC6 (Homo_sapiens) exosome component 6
Sequence
MPGDHRRIRGPEESQPPQLYATDEDEAPAARDPVRLRPVYARAGLLTQAKGSAYLEAGDT
KVLCAVSGPRQAEGGERGSGPAGAGPAPIWLLDPTRLEEERAAAGLTVALMPVLNQVAGL
LGSGEGGQIESWAEAVRLGLEGCQRLYPVLQQCLVRAARRRGAAAPP
Download sequence
Identical sequences G5B5W4
HGL_H00000398597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]