SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000401216 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000401216
Domain Number - Region: 90-123
Classification Level Classification E-value
Superfamily SAP domain 0.00435
Family SAP domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000401216
Sequence length 294
Comment DPPA2 (Homo_sapiens) developmental pluripotency associated 2
Sequence
SFQSNLLEEEADEENVILTLIPVTEEFEQGFNEESSISSTADFQHDSITPMSSRNSNAVH
LPQMNEELKACPKPKYRAPAPPLPTTLPPVNQVTRDTLRSWCQQFNLSTDGQKIEVYLRL
QRHAYPQQQCDIPGTLEETKVQLNFKKGKTGRKRRVNPLDRRKKEEEANVVEVVSSAQES
MLASWARIAAKAGQPKAVTSCPIPSSVEAFLQQASGCRWCVVHGQLLSANMAGWVRLQFC
GGHAWVPSTPRRMISLFLLPACIFPSPGTEDNMLCPECVQRNKKIMTKLIMEEK
Download sequence
Identical sequences G5AUN6
HGL_H00000401216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]