SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000401910 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000401910
Domain Number 1 Region: 405-626
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-55
Family DBL homology domain (DH-domain) 0.00016
Further Details:      
 
Domain Number 2 Region: 192-323
Classification Level Classification E-value
Superfamily BRCT domain 1.26e-23
Family DNA topoisomerase II binding protein 1, TopBP1 0.057
Further Details:      
 
Domain Number 3 Region: 105-219
Classification Level Classification E-value
Superfamily BRCT domain 9.26e-20
Family DNA ligase 0.032
Further Details:      
 
Domain Number 4 Region: 617-762
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000205
Family Pleckstrin-homology domain (PH domain) 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000401910
Sequence length 856
Comment ECT2 (Homo_sapiens) epithelial cell transforming sequence 2 oncogene
Sequence
MADSSVLTPTTGGTSMADSSIFDSKVTETSKENLFIGSTSYAEEEMPQIETRVVMVQEAG
KQEELIKALKEIKVTCIKMDSMEEFESLDSPEFENVFIVTDFQNSVFNDLHKGDCRIIGP
PVVLDCAQKGEPLPFSCRPLYCTSMMNLVLCFTGFRKKEELVRLVTLVHHMGGVIRKDFN
SKVTHLVANCTQGEKFRVAVSLGTPIMKPDWIYKAWERRNEQDFCAAVDDFRNEFKVPPF
QDCILSFLGFSDEEKTNMEEMTEMQGGNYLPVGDQRCTHLIVEENTVKELPFEPSKKLYV
VKQEWFWGSIQMDARAGETMYLYEKANTPELKKSVSLLSLHTPNSNRKRRRLKESLAQLS
KETDVSPFPPRKRPSAEHSLSIGSLLDISNTPESSINCGETPKSCSKSSKNSTPAPSKQS
ARWQVAKELYQTESNYVNILATIIQLFQVPLEEEGQRGGPILAPEEIKTIFGSIPDIFDV
HTKIKEDLEDLIVNWDESKSIGNIFLKYSKDLVKTYPPFVNFFEMSKETIIKCEKQKPRF
HAFLKINQAKPECGRQSLVELLIRPVQRLPSVALLLNDLKKHTADENPDKSTLEKAIGSL
KEVMTHINEDKRKTEAQKQIFDVVYEVDGCPANLLSSHRSLVQRVETVSLGEHPCDKGEQ
VTLFLFSDCLEIARKRHKVIGTFRSPPGHTRPPASLKHICLMPLSQIKKVLDIRETEDCR
NAFALLVRPPTEQANVLLSFQMTSDELPKDNWLKMLCRHVANTICKADAENLMYTADPES
FEVNTKDMDSTLSRASRAIKKTSKKVTRAFSFSKTPKRALRMALMPSHNSVEGRSPPSND
KHAVSRLSSTSSLAVS
Download sequence
Identical sequences G5BT69
HGL_H00000401910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]