SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000402038 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000402038
Domain Number 1 Region: 36-96,127-315
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.99e-39
Family FAD/NAD-linked reductases, N-terminal and central domains 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000402038
Sequence length 705
Comment MTO1 (Homo_sapiens) mitochondrial translation optimization 1 homolog (S. cerevisiae)
Sequence
MFSLRGRGLWVAASLSRQHLPSARLSGDCSAPGSPHFDVVVVGGGHAGTEAAAAAARCGS
QTLLLTHRVDTIGQMSCNPSFGGIGKGHLMREIDALDGLCSRICDQSGVHYKVLNRRKGP
AVWGLRAQIDRKLYKQNMQKEILNTPLLTVQEGAVEDLILTQPEPGHPGRCRVSGVVLGM
YWLQVLITAYQTPVDGSAVHAESVILTTGTFLRGTVVIGLETHPAGRLGDQPSIGLAQTL
EKLGFVVGRLKTGTPPRIAKESIDFSILNKQTPDDPSVPFSFVNETVWIKPEDQLPCHLT
HTNSAVDAIILENLHLNSHVKETASGPRYCPSIESKVLRFPNRVHQVWLEPEGMDSDLIY
PQGLSVTLPAELQQKMILCIRGLEKAKMVQPGYGVQYDYLDPRQIEPSLETHLVQRLFFA
GQINGTTGYEEAAAQGVIAGVNASLRVSRKPPFIVSRTEGYIGVMIDDLTTQGTSEPYRM
FTSRAEFRLSLRPDNADSRLTFRGYEEAGCVSQQRYNRAAWMKSSLEEGISVLKSIEFSS
SKWKKLIPQVSISTSRSLPVRALDVLKYEEVDMELLAKAVPDLLKKYTECRELAERLKIE
ASYESVLLCQQQEIQEVQRDEALQLPEDLDYLSVRDVSLSHEVREKLHFSRPRTIGAASR
IPGVTPAAIINLLKFVKTTQQRQTVMNGSPQTDQHLHSRAKFQEL
Download sequence
Identical sequences G5ALK6
HGL_H00000402038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]