SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000403293 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000403293
Domain Number 1 Region: 522-576
Classification Level Classification E-value
Superfamily RING/U-box 0.0000171
Family RING finger domain, C3HC4 0.065
Further Details:      
 
Weak hits

Sequence:  HGL_H00000403293
Domain Number - Region: 402-434
Classification Level Classification E-value
Superfamily F-box domain 0.00196
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000403293
Sequence length 602
Comment FBXO43 (Homo_sapiens) F-box protein 43
Sequence
MLIHKHPEISDLGSIHSLESPTQRNKFVFPRKEKDKTPELCETPKIGGKKSLLRRRLDVS
FSLLKKDFESQNSSQSSISQVLNLEKCIPNSASGFPRQNNFSPLVTSSVKTEEVISSRQN
LRLNFSQHKTSTVDDSKDDGSLFEVECISPIQGNNFKDSITHDFSDSSLSVNDENTYPEL
LGSSGSRTTYRRDEDIFVTPVSNFFAASQTLSPSIEVRGNISTPEDSGFNSLSLDKSEDS
FSDQEGSFQELLQKYKGTHNVGDTIRKSGRLGRSRRLSTLREQSSQSETEEEKQVIHPNS
ETRPAAATDILESQPSTDSKSRDLTLSFKNLSKTPALQLVHELFMKSKRKRFQGKNTNEF
LEERDGGKIAVLQCALAGLIGKKMGIEQLDILSELKYRNLKHILTMVLDFLTAESLYSVW
KVSRNWCEIVVQDKKANRRRKCYITQLKANSEGAVLNVEDAATRLRLLNRAALRSVQAQA
RTPSTQKEQVPTLSPWGEVLIPVASSSLTHLSSKQEEYVKVAKTLFTDEALKPCPRCQSP
AKYQPYKKRGLCSRTACGFDFCVLCLCAYHGSEECSKGIAKPRNRKDPLPGSAQSKRNLK
RL
Download sequence
Identical sequences G5ANZ2
HGL_H00000403293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]