SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000405573 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000405573
Domain Number 1 Region: 2-490
Classification Level Classification E-value
Superfamily SIS domain 4.45e-215
Family Phosphoglucose isomerase, PGI 0.0000000000000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000405573
Sequence length 494
Comment GPI (Homo_sapiens) glucose-6-phosphate isomerase
Sequence
MKMLVELAKSRGVEAARERMFSGEKINYTEDRAVLHVALRNRSNTPMLVDGKDVMPEINR
VLDKMKSFCQRVRSGDWKGYTGKAIMDVINIGIGGSDLGPLMVTEALKPYSAGGPRVWFV
SNIDGTHIAKTLANLNPETSLFIIASKTFTTQETITNAETAKEWFLMSAKDASAVAKHFV
ALSTNTAKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMD
QHFRTTPLEKNAPALLALLGVWYINCFGCETQALLPYDQYLHRFPAYFQQGDMESNGKYI
TKPGVRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKI
LLANFLAQTEALMKGKSTEEARKELQAAGKSPRDLEKLLPHKVFEGNRPTNSIVFTKLTP
FILGALIALYEHKIFVQGVIWDINSFDQWGVELGKQLAKKIEPELDGSDAVTSHDSSTNG
LINFIKQQREARTE
Download sequence
Identical sequences G5BXL7
HGL_H00000405573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]