SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000406305 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000406305
Domain Number 1 Region: 82-296
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.35e-57
Family GHMP Kinase, N-terminal domain 0.00000000891
Further Details:      
 
Domain Number 2 Region: 300-472
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 7.04e-54
Family Galactokinase 0.00000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000406305
Sequence length 474
Comment GALK1 (Homo_sapiens) galactokinase 1
Sequence
MGLPSGRLAARSPQPRQTELRADPPVALQLVAQRTQPGGGAGRQRGGASGLARTRSSGPA
PSIQPATRRAADSVMAASRPPRLEELLAEARRAFREEFGADPELAVSAPGRVNLIGEHTD
YNQGLVLPMASEGPAVAALELVTLLVGSPRTDRLVSLLTTSKDADEPQRLQFPLPTAQRS
LEPGIPRWANYVKGVIQHYPASPLPGFSAVVVSSVPLGSGLSSSASLEVATYTFLQQLCP
DSGAVAARARVCQRAEHSFAGVPCGIMDQLIALLGQKGHALLIDCRSLETSLVPLSDPKL
AVLITNSNVRHSLGSSEYPLRRRQCEEVARALGKESLREVRLEELEAGRELVSKEGFQRA
RHVVGEIQRTAQAAAALSRGDYRTFGRLMVESHHSLRDDYEVSCPELDQLVEAALSVPGV
YGSRMTGGGFGGCTVTLLEASAAACAMQHMQEQYSGTATFYLSQAADGAKVLYL
Download sequence
Identical sequences G5BNA5
HGL_H00000406305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]