SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000409205 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000409205
Domain Number 1 Region: 22-140
Classification Level Classification E-value
Superfamily Lysozyme-like 1.27e-40
Family C-type lysozyme 0.0000459
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000409205
Sequence length 141
Comment SPACA5B (Homo_sapiens) sperm acrosome associated 5B
Sequence
MQFLGTVIVILSILMAPNVDAKIFEHCELAKKLEKAGLNSYKGYSIRDWLCMAHYKSGFD
TSFVDHNPDGSSEYGIFQLNSAWCDNGITPTKNFCHMDCQDLLNHHILDDITCAKLIVYS
KNSMDAWDSWSQHCSGHDLSE
Download sequence
Identical sequences G5AXP3
HGL_H00000409205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]