SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000413684 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000413684
Domain Number 1 Region: 75-177
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.96e-35
Family Chaperone J-domain 0.0000451
Further Details:      
 
Domain Number 2 Region: 325-413
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 2.88e-24
Family HSP40/DnaJ peptide-binding domain 0.0003
Further Details:      
 
Domain Number 3 Region: 236-333
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 8.63e-16
Family HSP40/DnaJ peptide-binding domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000413684
Sequence length 420
Comment DNAJB5 (Homo_sapiens) DnaJ (Hsp40) homolog, subfamily B, member 5
Sequence
MFKRTVLSCPPPTAPPLQARGAFRSFPHFWGEDFLASLMFKIQLEPLKLRAWTLNGFVKF
RNKETSTGPVAVMGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEI
AEAYDVLSDPKKRSLYDQYGEEGLKTGGGTSGGSSGSFHYTFHGDPHATFASFFGGSNPF
DIFFASSRSTRPFSGFDPDDMDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKVQD
PPVVHELRVSLEEIYHGSTKRMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKITFP
KEGDATPDNIPADIVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGCTVNIPTIDGRVI
PLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHLPCS
Download sequence
Identical sequences G5BXB7
XP_004873970.1.39548 XP_004873971.1.39548 XP_010617581.1.5607 HGL_H00000413684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]