SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000416515 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000416515
Domain Number 1 Region: 152-374
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.2e-54
Family C-terminal domain of adrenodoxin reductase-like 0.00000000675
Further Details:      
 
Domain Number 2 Region: 49-210
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2e-19
Family N-terminal domain of adrenodoxin reductase-like 0.00000574
Further Details:      
 
Domain Number 3 Region: 352-502
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.00000188
Family N-terminal domain of adrenodoxin reductase-like 0.000000777
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000416515
Sequence length 503
Comment FDXR (Homo_sapiens) ferredoxin reductase
Sequence
MCSEGYGVRGQAIRGSVAGSWMKCGALDEDQAFRGSAPAFYQRFSTQTTPQICVVGSGPA
GFYTAQHLLKHHNQAQVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTAHSERCAFR
GNVAVGRDVTVSELREAYHAVVLSYGAEDHQALGIPGEELPGVCSARAFVGWYNGLPENQ
ALAPDLSCDTAVILGQGNVALDVARILLTPPEHLEKTDITEAALGLLRQSQVKTVWIVGR
RGPLQVAFTIKELREMIQLPGTRTILDPADFLGLQDRIKEVPRPRKRLSELLLRTAIEKL
GPEEASRQASASRAWGLRFFRSPQQVLPSPDGQQAAGIRLAVTRLEGVGEATRAVPTGET
EDLPCGLVLSSVGYKSLPIDPSVPFDPKLGVIPNTEGRVVDVPGLYCSGWVKRGPTGVIA
TTMTDSFLTSEVLLQDLKAGLLPSGPRPGYTAIQALLSSRGIRPVSFSDWEKLDAEEVSR
GQGAGKPREKLVDSQEMLRLLGC
Download sequence
Identical sequences G5BNE0
HGL_H00000416515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]