SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000416558 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000416558
Domain Number 1 Region: 269-473
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 5.58e-24
Family Regulator of chromosome condensation RCC1 0.0042
Further Details:      
 
Domain Number 2 Region: 39-125
Classification Level Classification E-value
Superfamily F-box domain 1.83e-16
Family F-box domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000416558
Sequence length 589
Comment FBXO24 (Homo_sapiens) F-box protein 24
Sequence
MVRRSQRQKLKKLTGLCGREEGLRVKRNCPSCGPEYESDEKGRENSISVQLFPPELVEHI
ASFLPVRDAVALGQTCHYFREVCDTEGVWRRICHRLSPHLREQGSGVRPWKRAAVLNYTK
GLYFQAFGGRRKCLSKSVAPLLAHGYRRFLPTKDHIFILDYLGTLFFLKNALVSTLGQIQ
WKRACRYIVLCRGAKDFASDPRCDTVYRKYLYVLVTGKQSGVAGTTSSRACDCVEVYLQS
SGQRVFKMTFHYSMSFKQISLLGQETQRALLLLTEEGKIYSLVVNETQLDQPRSYTVQLA
LRKLSCCLPHLRVSCMTSNQSSVLYMTDQGGVYFEVHSPGVYRDFFGTLQAFDPLDQQMP
LAVSLPAKVLFCALGYNHFGLVDEFGRIFMQGNNRYGQLGTGDKMDRGEPTLVPYLQRPI
ALWCGLNHSLVLSQDSDFSKELLGCGCGAGGRLPGWPKGSASFVKLHVKVPLCACSLCST
RECLYMLSSHDIEHCLSYRDLPAPWAVDSLEPSLGARAPQDTGVAAWAFEEYLSQIHSCS
TLQDRMEKMKEIVGWMPLMAAQKDFFWEALNILQKTPGGAAPGPSTPES
Download sequence
Identical sequences G5BC01
HGL_H00000416558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]