SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000418111-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000418111-1
Domain Number 1 Region: 116-374
Classification Level Classification E-value
Superfamily RNI-like 9.61e-38
Family Cyclin A/CDK2-associated p19, Skp2 0.034
Further Details:      
 
Domain Number 2 Region: 90-126
Classification Level Classification E-value
Superfamily F-box domain 0.0000654
Family F-box domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000418111-1
Sequence length 382
Comment FBXL17 (Homo_sapiens) F-box and leucine-rich repeat protein 17
Sequence
MYHMGLSAATPRGRLVPGPEQPKPQPLCSQPSSPPSESASIEAGGDSVRAGGTAPSSAKQ
QPECGDMNGQEPPQNPCDSQREPPPETPNINQLPPSILLKIFSNLSLDERCLSASLVCKY
WGDLCSDCQFWKQLDLSSQQQVTGELLEKIASRSQNIIEINISDCRSMSDTGICVLAFKC
PGLLRYTAYRCKQLSDTSIIAVASHCPLLQKVHVGNQGKLTDDGLKQLGSKCRELKDIHF
GQCYKISDEGMIIIAKGCLKLQRIYIEENKLVTDQSVKAFAEHCPELQYVGFMGCSVTSK
GLIHLTKLRNLSRLDLRHISELDNETVMEIVKRCKNLSSLNLCLNWIINDRCVEVIAKEG
RNLKELYLVSCKITDYALIAIG
Download sequence
Identical sequences G5BAR8
HGL_H00000418111-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]