SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000418157-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000418157-1
Domain Number 1 Region: 131-383
Classification Level Classification E-value
Superfamily Poly A polymerase C-terminal region-like 8.11e-48
Family Poly A polymerase C-terminal region-like 0.000000013
Further Details:      
 
Domain Number 2 Region: 31-129
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.00000000000000153
Family Poly A polymerase head domain-like 0.0000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000418157-1
Sequence length 384
Comment TRNT1 (Homo_sapiens) tRNA nucleotidyl transferase, CCA-adding, 1
Sequence
MLRHLYPWHRPLVSCSWSRLCLLKRYLFTMKLQSPEFQSLFTEGLKSLTELFIKENHELR
IAGGAVRDLLNGVKPQDVDFATTATPTQMKEMFQAADKQQRRKAWNNYCQGFDGTLYDYF
NGYADLKSKKVKFVGHAKQRIQEDYLRILRYFRFYGRIVDKPGDHDPETLEAIAENAKGL
GGISGERIWVELKKILTGDHVNHLIHLIYDLDVAPYIGLPANASLEEFNKVSKNVDSFSP
KPMTVLASLFKVQDDVTQLDLRLKISKEEKNLGLFIVKNRKDLVKATDSSEPLKPYQDFI
IDSREPDMTGRVCELLKYQGEHRLLKEMEQWSIPPFPVSGHDIRKVGISSGKEIGALLQQ
LREQWKRSGYQMEKEELLSYIKKP
Download sequence
Identical sequences G5BKR8
HGL_H00000418157-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]