SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000418960 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000418960
Domain Number 1 Region: 1643-1748
Classification Level Classification E-value
Superfamily BRCT domain 9.81e-23
Family BRCT domain 0.00000618
Further Details:      
 
Domain Number 2 Region: 1752-1850
Classification Level Classification E-value
Superfamily BRCT domain 3.01e-20
Family BRCT domain 0.000024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000418960
Sequence length 1856
Comment BRCA1 (Homo_sapiens) breast cancer 1, early onset
Sequence
MPFSPVHAHPGLIPPGVVLRSLQESTRFSQLVEELLKVIRAFELDSGLQVANSYNFSKKE
INSPEHGQEEIPLIQSMGYRNRARGLRQGEPEKPSLETSLGVQLSDLGIVRSLRTKKQAQ
PQNKSVYIELGSDSSEDASEDVANRADDHSVRDQDLLFSLQGTRAKASSHPAKQGNTPCE
ASEKGTVDSDRPHLSGEDEKPVEKRAAKRRPGKQQVGPAPDLRVEPCGTDTRASSLQCRN
SRLLLTEDRMDVEKAEFCNKSKQPGFARSQQSRWAGSEESSDDGQTPSTEQKAEPTAAAL
CERRGKEQKPPCSETLGEAQDVYWVTLNSRIQKVNEWFSRSDKVVASDDACDRELEADAE
EASALEDPKGQGGFSGSLEKIAMLTNSPQSALFCANKRVCPKAGRNDMKDKVFGKTYRRK
PSLPSFTYVAENLTVGALVVKPQVTQEFPPTNKLKRKRRSMSCLHPEDFIKRADLPVAPK
TPEKINQGTEQMEESGQVTGTPRKSHKGDAEGAGVQRQRKPSPAQSLEKESAARAEPQSC
SISNMGLESHARHSEPPKKSRLRRRSSTRHVPHPSPLDHTELQIDNSTSTEEVKEKSSHQ
VLIGYSQNLYLAGEGEASIGIPESKKPAEQVRNRPAEEAVPEPALANTPGSSANSSGPDK
ELVNPSPQRDKTEENPETVQVSDNTRDPKGPVLSGERGLQTERSAESTSISLVPDTDYST
QDSFSLLEANSLRKAQRASHQCVTQYVAVAKPKELPAHSEDTGNDTEGFNDPLRRKVSHV
QEANVEMEDSELDTQYLQNTFQASKRQSFALFSNPGNPEKKSTGVCAHSEFFQKRNPEVT
PECEQRENSKGKKASKIRHVQVVNATASVPVISQNDQLGVGVQCGVTGVSKLRPSSQVRG
YKTELVAADKHGISRNPCHVASVSRIGTSVKTACKKSLSMSPKEAVESERVLQSMVSTGC
CKNSRDLAPKEASSGSGSGVGSGTNEVASSNEHMQAEWGRSRGPTLNAVLRSGLMQPKVQ
EQSLPVGDYKCPKIPQRGASGVVAQAVHADFSPCLIFDSVEQPMGSNPASQICSETPDDL
LDEEDRKEDASFAEDDIKETSAVFSKSVQRRQXXXXXXSRSPSPFTHTALARGHQRRVRK
LESSEENMSSEDEELPCFQHLIFGKGCTTPQSTRPSTGATERVSKGTEENVVSLKDNLRG
CTSEPVSPEPRLGEDIRCSGSLFSSQCSISEESAANTISQDXQKGHPSGIQGASLSDKEV
VSDDEDREPSLEEGSHHGGQSVDSPLGEAASGYESETNPSGGFSGLSSQSSILTTQQKDT
IQDNLLRLQQEMAQLEAVLERHGSQCSNSSTSIVPDSCPAEDLATLGRYIPGKAPVNWVP
EVLTPAHSPGALSSSHQCCCLPKRVEPMFPTYEERSMLEHLGWLQGDFSVFQNLVRIPVF
MLPKPDKTKKENRCLCFFDPLKAGFTSGRSNAYPVTQSLQACPSSKHQVSPDCPASENKE
PGAGRSSPPEAQVADSQWSAHSQPRRLRDRGCPAPEQLEEEEELGESGPHHATALAHLPR
RELDNPEPEASEDRAPEPAHVCRALVPTPTSALTLSPFQVAEPAGTPAAAQTSNPARGAS
KEEAVSREEPESLSSVGGGRRRLSMVVSGLTTKESVLVQKFARKHHIGLTSLITAETTHV
VMKTDPEFVCERTLKYFLGIAGGKWVVSYFWVTQSMQERRMLDECDFEVRGDVINGRSHQ
GPKRARESQDRKIFGGLTVCCCGPFTNMATDQLEWMLRLCGASVVGELSALPLSTGAQSV
VVMQPEAWTEDADFLALGQLCQVPVVTRDWVLDSVALHQRQELDAYLIPQDPHRPR
Download sequence
Identical sequences G5BN95
HGL_H00000418960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]