SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000419370 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000419370
Domain Number 1 Region: 92-193
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.96e-29
Family Iojap/YbeB-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000419370
Sequence length 232
Comment C7orf30 (Homo_sapiens) Uncharacterized protein C7orf30
Sequence
MGTSSRVALRLGSLLWRGAASRGGDSAVAAMPRLQLLALGRLPAGPAPFRAYLTPDLVCG
LHSRPQRDERTGGEARPEPGAADHTGPKFDIDMLVSLLRQENARDICVIKVPPEMRYADY
FVIGSGTSTRHLHAMAYYIVKMYKYLKCKSEPHVKIEGKDTDDWLCVDFGSMVIHLMLPE
TRETYELEKLWTLRSYDDQLSQIPPEMLPEDFILGIEEEDTSLLTPGEFKCE
Download sequence
Identical sequences G5BHC2
HGL_H00000419370 XP_004839613.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]