SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000420721 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000420721
Domain Number 1 Region: 1-52
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000968
Family HLH, helix-loop-helix DNA-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000420721
Sequence length 2195
Comment KIAA2018 (Homo_sapiens) KIAA2018
Sequence
VERHRKKKINAGINRIGELIPCSPALKQSKNMILDQAFKYITELKRQNDELLLNGGNNEQ
AEEIKKLRKQLEEIQKENGRYIELLKANDICLYDDPTIHWKGNLKNSKVSVVIPSDQVQK
NIIVYSSGSQPGGNSQGTAVQGITFNVGHNLQKQTANVVPVQRTCNLVTPASVSGIYPSE
KKPWHQTTVSALAANQPVPLCLPAAISAQNILELSTSESESSVLGASGGSLIAVSVGPEL
HQYPSSHICTNDQNSSENNSGLDSTKLLKKTAPCVTSVSPSSSATTTKVHHGIKSCLSLQ
NCRGDFQNTFVVSVTTTICSQPPRSSGDSSPLSISKCTDSTNKTTVVAPSAPSVGKITTP
ALSANPLDNGWTLSCSLPSSSASASDLKNINSLTRISSAGNTQTTWTTLQLAGNTIQPLS
QTPSSTVTPVLSESSTSPPTSNHSRHVATGINLNNSLPADGQPVEQVVVTLPSCPPLLMQ
PLISQPQVKSQPPKNILPLNSAMQVIQMAQSVGSAVNAASANQNVIILQPPSTTPCPTVM
RAEVPNQTVGQQIVIIQAANQNPLPLLSAPPSGSVRLPVNGANAIIGSNNSVQNVSTPQT
FGGKHLVHILPRPSSLSTSNSTQTFSVTMSNQQQPQTISLNGQLFALQPVMSSSGTTNQT
PMQIIQPTTSEDPNTNVALNTFGALASLNQSISQMAGQSCVQLSISQPANPQTATNSQTT
PANCVSLTTTIAPSTTTDNSATLPNTYNFVTTSSVNTVACLPPTMKSKRLNKKPGAKKHL
AASKPACILNPVKVGKLDCPRTEGSAESPCNDGLLESLPIVLPSVAVSEANNVSVSASHS
LDILNSESVMPESVSKSKSAEVSPCQESVTSEHSAAAPEKSKDSMPILQQETSQDKPPTS
LALSDATKSCTSANVLIPSPSDPQVLASQVSGLSSTTSTASTDYVSEVEIVAEPCRVDQD
SSDTIQATGLLKGQGLTTLLSDLAKEKDPQKSSLSVQIDHPDFSSENSKVVNSSVDLHPK
QELLLMNSEDSLPDQEVMNGSLLTRQADSPMSTSSGSSRSFSVASMLPETTREDVTSSTT
NTCDSCTFVEQTDIVALAARAIFDQENIEKERVGIQADIREVTSKSSEASSLEGDQPFKS
HPKENGTRQAETTPNEFNSQDSIEITVDRPLEKPSCSLGIKTSNASLQASTSQPPTLTSL
SVNNLIHQSSITHPLVSCAGLSQTSDQTAVPTTVNLTVSSSSYGSQPPGPSLMTEYSQEQ
LNTMASTIPNSQIQEPLLKPNHENRKDSAKRAIQDDLLLSSAKRQKHCQPVPLRLENMSL
MSRTPDNISDQAQMMVSQIPPNSSNSVVPVSNPAHGDGLTRLFPAGNNFVAPALRQTEVQ
RSSQPSVAEQQQTPASQHLQALQQHVPPQGVSHLHSNHLYIKQQQQQQQAGQLRERHHLY
QLQHHVPHGENAVHSQPHNVHQQRTLQQEVQMQKKRNLVQGTQGSQLSLQPKHHATDQSR
PKSGQPHPHHQQMQQQMQQHFGSSQPEKSCENPSASRNHHSHPQNHLNQDIMHQQQDVGS
RPQGSGVTSEHVSGHNPMQRLLTSRGLEQQMVSQPSIVTRSSDMTCAPHRTERNRVSSYS
AEALIGKTSSNSEQRMGILIQGSRVSDQLEMRSYLDVPRNKSLAIHNMQSHVDHTVASDI
RLSDCQTFKPSGASQQPQSNFEVQSSRNNEIGNSVSSLRSMQSQAFRISQNGPPAIDRQK
RLPYPPVQGIPAGNAIPPRDSENTCHQSFMQSLLAPHLGDQVIGSQRSLSEHQRNTQCGP
SSAIEYNCPPTHESVHIRRDSESQNRESCDMSLGAINTRNSTLNIPFSSSSSSGDIQGRN
TSPNVSVQKSNPMRITDSHGTKGHMNPPVTTNMHGVARPALPHPSVSHGNADQGPPVRQA
NTSVSQRSRHPLQDSGSSKIRQPERNRSGNQRHSNVFDPSLPHLPLSTSGSMILGRQQPA
TEKRGSIVRFMPDSPQVPNDNSGPDQHSLSQNFGFPFIPEGGMNPPINANTSFIPQVTQP
SATRAPALIPVDPQNTLPSFYPPYSPAHPTLSNDISIPYFSNQMFSNPTTEKVNSGSLNN
RFGSILSPPRPVGFAQPSFPLLPDMPPMHMTNSHLSNFNMTSLFPEIATALPDGSAMSPL
LTIANSSASDSSKQSSNRPAHNISHILGHDCSSAV
Download sequence
Identical sequences G5AL30
HGL_H00000420721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]