SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_M00000025305 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_M00000025305
Domain Number 1 Region: 91-170
Classification Level Classification E-value
Superfamily Ribosomal protein S18 1.96e-24
Family Ribosomal protein S18 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_M00000025305
Sequence length 253
Comment Mrps18b (Mus_musculus) mitochondrial ribosomal protein S18B Gene
Sequence
MAASVFNTLLRRYLTLSPFRGFYGVQVPLQTFCTEAPPGKDSLPPAPLSPYENEPWKYLE
SEEYLSRYGSRPIWADYRRNHKGSVPRQRTRRTCIRKNKVAGNPCPICRDHKLHVDFRNV
KLLEQFVCTHTGIIFHAPYTGVCMKQHKKLTQAIQKARDHGLLSYHVPQVEPRDLDFSTS
HGAVSATPLAPTLLSGDPWYPWYSWKQPPERELSRLRRLYQGSLREESGPPPEAMPEEPP
VSPAEATCAEQSP
Download sequence
Identical sequences G5C3B7
HGL_M00000025305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]