SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_N000003525551 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_N000003525551
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.53e-40
Family N-terminal domain of xrcc1 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_N000003525551
Sequence length 124
Sequence
MAPVKISHVVSFSSQDPKYPVENLLNTDSQRGPWLGCPQDKSGQLKVELQLERAVPISYI
DVGNCGCAFLQIDVGRSSWSLDRPFITLLPATMLMSLTDSKQGKNRSGVRMFKDGKEGQG
RSWG
Download sequence
Identical sequences G5AVS9
HGL_N000003525551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]