SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_N000003885311 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_N000003885311
Domain Number 1 Region: 48-165
Classification Level Classification E-value
Superfamily RNI-like 0.00000000549
Family Cyclin A/CDK2-associated p19, Skp2 0.093
Further Details:      
 
Domain Number 2 Region: 3-32
Classification Level Classification E-value
Superfamily F-box domain 0.0000301
Family F-box domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_N000003885311
Sequence length 175
Sequence
LQMLTYILSFLPLSDQKEASLVSRAWYCAAQNALREVSLGLRGISCISLTNLDGSPTSQQ
VLQSVAYHLGLHLQSLCLGGGSPTEASFVALILGCPALHTLVLSGCNSLFISGMLFTQPE
MAQNVRQALSGLCELNLAGLRDLGDLSFNQLCSCVPNLEHLSLAYSHPTFQLGAA
Download sequence
Identical sequences G5C653
HGL_N000003885311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]