SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_N10001002 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_N10001002
Domain Number 1 Region: 85-203
Classification Level Classification E-value
Superfamily SIS domain 3.94e-18
Family double-SIS domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_N10001002
Sequence length 250
Sequence
MMPLCPCSAIIEHTNRVIFLEDDDIATVADGKLSIHRVKCSASDDPSRAIQTLQVELQQI
MKGRILFPYFTVLCPALSQAADVRDGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTELL
GGLKDHLKEIRRCRRLILIGCGTSYHAAVAKIKEMTYMHSEGILAGELKHGPLALVDKQM
PVIMVIMKDPCFAKCQNALQQCMALFTSVTRVLHEQIMHMTTRGGAGDSQKCAQGGEKPD
FCRNPRKLGN
Download sequence
Identical sequences G5BS66
HGL_N10001002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]