SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_N10001971 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_N10001971
Domain Number 1 Region: 9-84
Classification Level Classification E-value
Superfamily SIS domain 6.04e-21
Family Phosphoglucose isomerase, PGI 0.0000427
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_N10001971
Sequence length 88
Sequence
MAVIILQLLKKLLPHKVFEGNCPTNSIVFTKLTPFILGALTALYEHKIFVQGIIWDINSF
ASDAGTTHSSTTNGLINFIKQRREARAE
Download sequence
Identical sequences G5AW06
HGL_N10001971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]