SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_N10016895 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_N10016895
Domain Number 1 Region: 505-581
Classification Level Classification E-value
Superfamily HMG-box 0.0000000000000956
Family HMG-box 0.0021
Further Details:      
 
Domain Number 2 Region: 6-63
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000209
Family HLH, helix-loop-helix DNA-binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_N10016895
Sequence length 624
Sequence
MVSVRRNRKKSHTSQLQELALLIPVTLKTGSKKLTKKEILLHVLHYIQYLQRTIDVVKAL
LKIYLRSEEGGLGGVGKNHVLSPGSCAHQSFFWKQKEILLHVLHYIQYLQRTIDVVKALL
KIYLRSEEGGLGGLGWNPATGPARQRHSTPSSSPCCQNSQLWGACQKPQKKQLTQAELET
WPQKSRSSLALDTPKKLVISSDQKEENMGRTTTSPRCPDACDSPKAVLSSQEGNADGEAG
AQLMLLDMTKDIDFDDITSSCCTDGAQDDEPDPAFEDESRGEMTYFLSETLFYPSQQVVF
YDSSEEVDNDADPWLPVCTPEGSSQESLLALPPPQVPTWSVTGHPDKILGLSPSLFSSPS
KLLPEQILEDDTMFLTQGLFEEVLLDSESPPSACVLAAPQEKDSPSRAPKVPPDFYSLCQ
SSVFLDHCYLSLSDNSKALSSPSSEDTDTDSLWEQEEDTQADPEDSQSSNDEDDDYTWTP
SQRASTLPAPGRRARKGPASKGLVKPKESKKAPCPTKVKKKCVNGFIMFCRMNRKPYIRA
CPGTASTAATRELARLWRVMTQKERRPYCTKARRFSRQHNRIVKQDSSNSENEDWETPKP
FYQLLAEKARVSSDLASAPPPHRD
Download sequence
Identical sequences G5AUX7
HGL_N10016895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]