SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_N10020287 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_N10020287
Domain Number 1 Region: 1-32
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00000329
Family Translational machinery components 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_N10020287
Sequence length 73
Sequence
MKKQPRGCGLRCHRAIITICRLTGIKDTYAKRALRKDLEPEDEVPDIKLDWEEVKAAQGM
KRSVWSGLKRAAT
Download sequence
Identical sequences G5ALK4
HGL_N10020287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]