SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_N10020431 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_N10020431
Domain Number 1 Region: 55-134
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 4.73e-22
Family Transforming growth factor (TGF)-beta 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_N10020431
Sequence length 153
Sequence
MIGHEQESVLRKTPRNGYGESIEGHGEEEEEGEEKVVAGHIAMGSLLARQKRSIGAGSYC
QKTSLWVKFKDIGWDSWIIAPKEYDAYECKGGCFFPLSDDLTPTKHAIVQTLVCLKHPKK
MAKPAACPPNRAPSPSSIRMTWGCPPSSTTMRG
Download sequence
Identical sequences G5CAC1
HGL_N10020431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]