SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_N10024204 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_N10024204
Domain Number - Region: 42-122
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.0965
Family YaeQ-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_N10024204
Sequence length 145
Sequence
MCAPFFSDTFILVPKPGRHSYWDLWAHPTRAQSCTPDCPFLDLQLPNWGTHLRGSQSFAI
ADAAFNTSLILSTDLAAMAIVTAPKEPALWEFHVHQEWQCWQKHGQLGCHRASRAVPTSQ
PVPTPTKTLTLIRXDMEEETTTPVP
Download sequence
Identical sequences HGL_N10024204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]