SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000199708 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000199708
Domain Number 1 Region: 1-142
Classification Level Classification E-value
Superfamily Globin-like 2.65e-43
Family Globins 0.0000039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000199708
Sequence length 142
Comment HBQ1 (Homo_sapiens) hemoglobin, theta 1
Sequence
MELSAADQAAVRALWKKMGTNVGVYATEALERTFLAFPSTKTYFPHWDLSIGSAQVKALG
QKVADALTLAVDQLYDLPGALSALSDLHAHKLRVDPANFHLLGHCLLVTLARHYPGDFSP
AMQASLDKFLSLVTSALTSKYR
Download sequence
Identical sequences G5BXY0
HGL_H00000199708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]