SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000216330-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000216330-2
Domain Number 1 Region: 86-223
Classification Level Classification E-value
Superfamily FKBP-like 1.71e-37
Family FKBP immunophilin/proline isomerase 0.000000929
Further Details:      
 
Weak hits

Sequence:  HGL_H00000216330-2
Domain Number - Region: 26-88
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.0134
Family Mevalonate 5-diphosphate decarboxylase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000216330-2
Sequence length 224
Comment FKBP3 (Homo_sapiens) FK506 binding protein 3, 25kDa
Sequence
MAAAIPQRAWTVEQLRSEQLPKKDIIRFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLV
MAYNHLFETKRFKGTESVSKVTEQVKNVKLNEEKPKETKTEETLDEGPPKYTKSILKKGD
KTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSSKKKKNAKPLSFKVGVGKVIRGWDEALL
TMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLVFEVELVDID
Download sequence
Identical sequences G5BUQ7
HGL_H00000216330-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]