SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000219454 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000219454
Domain Number 1 Region: 17-59
Classification Level Classification E-value
Superfamily Elafin-like 0.0000111
Family Elafin-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000219454
Sequence length 153
Comment WFDC1 (Homo_sapiens) WAP four-disulfide core domain 1
Sequence
QVEEVSAPGHRQPLADRCPPPPRTLPPAACQAVRCQADSECPRHRCCCYNGCAYTCLEAV
LPPPVLDWLVQPKPRWLGGNRWLLDGPEEVLQAEACSTTEDGAEPLLCPSGYECHILIAG
NMAEGIPNRGQCVKQRQQADGQFLRHKFYKECP
Download sequence
Identical sequences G5BFY6
HGL_H00000219454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]