SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000219596 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000219596
Domain Number 1 Region: 623-803
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.68e-63
Family SPRY domain 0.00000365
Further Details:      
 
Domain Number 2 Region: 3-90
Classification Level Classification E-value
Superfamily DEATH domain 1.77e-23
Family Pyrin domain, PYD 0.003
Further Details:      
 
Domain Number 3 Region: 397-460
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.98e-16
Family B-box zinc-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000219596
Sequence length 810
Comment MEFV (Homo_sapiens) Mediterranean fever
Sequence
MAKTLSDHLLNTLEELVPYDFEKFKFKLQNTSLEKEHTRIPRGHLQMARPVRLATLLITH
YGEEYAVRLTLQVLRSINQRLLAEELHRATGQELGTQESCIDILATYSGENKPKSLKVPD
GPAGDEHRQSGNGAASLMSSQTEAVKGPQKKSQGKRRDPKGPEGLDLQGKLWARSAALPT
RRSPVPTQSQPGRLQGLCTGALGRRESKKSEVYLPSGKKRPKSLELSSEKEGPPNPETLL
TSLEEMRNGNADSAATSRVGAAVTLENGSRNPEYSMVMEEGISRITLSRASLAREEKSTA
SFEEEGTGYPDTLGKMTGGLFHKSSNPEVLSFSGRLQEEAACSLGHTQEGDQLGGTCVHG
SCSGPVASGDSQVSGNSLPNCPQCQASLARKSSGGVSPQALLQCQRHMKQELLLFCEDHG
ELICLICRLSQEHQGHRVRPIEEAALDYKEQIQKQLEHLKELRKSGEEQRSQGHMKTARF
LKQTETQKQRVQCQLEQLHRFLEQQEQLFLTWLEELGQTIGRVQETYGTRVSQDIALFDE
LIGKLEGKQRQSEWELMQDIGVTLHRAKMVTVPEPWATPPEVKEKIHLLYQKSEFVEKSI
KYFSDTLRSEMEMFNVQELTGAQEHAVEVFLDPATAHPNLVFSDDMKSVRLGGQWDRLPD
NPERFDSCIFTLGSPRFFSGCHYWEVEVGNKTAWVLGVCHASTSRKGSVTLTPENGYWVV
MMMKPNEYQASTIPPTHLRMSEPPKRVGIFLDWKTGHISFYNVTVRSHIYTFTSFSSSGP
LQPIFSPGTHDGGKNIGPLTICAVDGQGPH
Download sequence
Identical sequences G5B1I0
HGL_H00000219596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]