SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000221486 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000221486
Domain Number 1 Region: 29-248
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.12e-57
Family Ribonuclease H 0.0000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000221486
Sequence length 298
Comment RNASEH2A (Homo_sapiens) ribonuclease H2, subunit A
Sequence
MDLSELEKDNTGRSRLSSPVPAVCREEPCVLGVDEAGRGPVLGPMVYAICYCPESRLADL
EALKVADSKTLSESERDRLFAKMEEDQDLVGWALDVLSPNLISTSMLGRVKYNLNSLSHD
TATGLIQYALDQGVKVTQVFVDTVGLPEMYQKRLQQRFPEITVTVKAKADALYPVVSAAS
ICAKVARDQAVKSWQFVEKLQDLDADYGSGYPNDPKTKAWLRRHVEPVFGFPQLVRFSWR
TAQAILEKEAEGVTWEDSATEEQEGHRRITSYFQSEGPRARAPHRYFQERGLESATAL
Download sequence
Identical sequences G5BYW8
HGL_H00000221486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]