SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000232607 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000232607
Domain Number 1 Region: 237-477
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 7.74e-56
Family Decarboxylase 0.000000645
Further Details:      
 
Domain Number 2 Region: 10-204
Classification Level Classification E-value
Superfamily PRTase-like 2.75e-45
Family Phosphoribosyltransferases (PRTases) 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000232607
Sequence length 480
Comment UMPS (Homo_sapiens) uridine monophosphate synthetase
Sequence
MAAVGATLGHLVTALYEVQAFKFGDFVLKSGLSSPVYIDLRGIISRPRLLSQVADSLFQT
AQNAGISFDTVCGVPYTALPLAAVICSTHQIPMLIRRKETKDYGTKRLVEGALNPGETCL
VIEDVVTSGGSVLETIEALQKEGLKVTDAIVLLDREQGGRDKLQAHGIHLHSVCTLSTML
EILEQQQKIDAEMVGRVKRFIQENVFAATHQNGSLLAIKKAPEELSFAARAELPGIHPVA
SKLLRLMQKKETNLCLSADVSEARELLQLANTLGPSICMLKTHVDILDDFTLDVMKELTA
LAKQHEFLIFEDRKFADIGNTVKKQYEGGVFKIASWADVVNAHVVPGSGVVKGLEEVGLP
LHRGCLLIAEMSSAGSLATGDYTSAAVRMAEHHCEFVIGFISGSRVSMKPEFLHLTPGVQ
LETGGDHLGQQYNSPQEVIGRRGSDIIIVGRGILSAPNHLQAAEMYRKAAWEAYLSRLAV
Download sequence
Identical sequences G5AQ72
HGL_H00000232607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]