SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000244333 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000244333
Domain Number 1 Region: 29-125
Classification Level Classification E-value
Superfamily Snake toxin-like 2.06e-24
Family Extracellular domain of cell surface receptors 0.027
Further Details:      
 
Domain Number 2 Region: 137-226
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000022
Family Extracellular domain of cell surface receptors 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000244333
Sequence length 351
Comment LYPD3 (Homo_sapiens) LY6/PLAUR domain containing 3
Sequence
MVSARKAGALVAIWTTGWLLLFPLLLREGAQALECYSCVQKADDGCSARKMKTVKCAPGV
DVCTEAVGAVETIHGQFSVAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLN
LTSRGLNPTGNESAYQPNGAECYSCVGLSHEKCQGTVSPVVSCYNANNRVYKGCFDGNVT
LTAANVTVSLPVRGCVQDELCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPL
VLLPPPTTPAPSTPAPTTSVIASTLAPTTLTSTTKPTPTPASQTLPHEVQPDTSQKEESR
LVGGSAGHQDRSNVGQYPAKGWTTRPSSKGPAAPGAGLAALLLAVAGGALL
Download sequence
Identical sequences G5AZP2
XP_004873133.1.39548 HGL_H00000244333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]