SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000248933 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000248933
Domain Number 1 Region: 524-634
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.1e-24
Family Spermadhesin, CUB domain 0.00095
Further Details:      
 
Domain Number 2 Region: 342-463
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.11e-19
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 
Domain Number 3 Region: 641-706
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000125
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 700-762
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000625
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 5 Region: 177-284
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000824
Family Spermadhesin, CUB domain 0.0031
Further Details:      
 
Domain Number 6 Region: 768-827
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000105
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 7 Region: 288-349
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000667
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 8 Region: 463-527
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000526
Family Complement control module/SCR domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000248933
Sequence length 920
Comment SEZ6L (Homo_sapiens) seizure related 6 homolog (mouse)-like
Sequence
MNTVAPRKKLSSLKLVTSAWKTPRLKSTSTSTDPAKAEAHPAASADPGLHSSSIEKPRPP
GDMDLGVPSQPSSERPIWLQGKEGTVPTTPEPLQISPFTSKPLVAHTLLQRPKPGDPAAQ
AHKETPEAPAEDASPGTLMDKGDNELTGSASEESQETTTSTIITTTVITTEQAPALCSVS
FSDPEGYIDSSDYPLLPFNSFLECTYNVTVYTGYGVELQVKSVNLSEGELLSIRGVDGPT
LTVLANQTLLVEGQVIRSPTNTISVYFRTFQDDGLGTFQLHYQAFMLSCSFPRRPESGDV
TVLDLHSGGVAHFHCHLGYELQGAKTLACINASKPHWSSQEPVCSAPCGGAVHNATIGRV
LSPSHLGNSNGSQFCVWTIEAPEGQKLHLHFERLSLHDKDRMMVYSGQTNKSALLYDSLQ
TESVPFEGLLSDSNSIRVEFTSDQGQAASAFNIRFEAFEKGHCYEPYIQNGNFTTSDPTY
NIGTVVEFTCDPGHSLEQGPAIIECVNVRDPYWNDTEPLCRAMCGGELSAVAGVVLSPNW
PEPYVEGEDCVWKIHVGEEKRIFLDIQFLNLSNSDILTIYDGDEVVPHILGQYLGSNSPQ
KLYSSTPDLTIQFHSDPADLIFGKGQGFIMNYIEVSRNDSCSDLPEIQNGWKTTSHTELV
RGARITYQCDPGYDIVGSDTLTCQWDLSWSSDPPFCEKIMYCTDPGEVDHSTRLISDPVL
LVGTTIQYTCNPGFVLEGSSLLTCYSRETGTPIWTSRLPHCVSEESLACDNPGLPENGYQ
ILYKRLYLPGESLTFMCYEGFELMGEVTIRCILGQPSHWNGPLPVCKVNQDSFEHALEVA
EAAAESSLEGGNMALAIFIPVLIISLLLGGAYIYITRCRYYSSLRLPLMYSHPYSQITVE
TEFDNPIYETGETREYEVSI
Download sequence
Identical sequences G5BGM0
HGL_H00000248933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]