SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000252444 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000252444
Domain Number 1 Region: 436-697
Classification Level Classification E-value
Superfamily YWTD domain 7.19e-49
Family YWTD domain 0.00000000109
Further Details:      
 
Domain Number 2 Region: 102-142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000707
Family LDL receptor-like module 0.00034
Further Details:      
 
Domain Number 3 Region: 141-182
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000393
Family LDL receptor-like module 0.00019
Further Details:      
 
Domain Number 4 Region: 362-431,698-748
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000091
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 5 Region: 25-62
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.0002
Further Details:      
 
Domain Number 6 Region: 274-311
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0003
Further Details:      
 
Domain Number 7 Region: 211-247
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.0003
Further Details:      
 
Domain Number 8 Region: 312-351
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.0002
Further Details:      
 
Domain Number 9 Region: 61-104
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000252444
Sequence length 894
Comment LDLR (Homo_sapiens) low density lipoprotein receptor
Sequence
MRTAGPVLRYGALLLCLAAGAAEDKCARNEFQCWDGKCISYTWVCDGRAECQDGSDESQE
TCMAATCKPGDFSCGGRLTRCIPSSWRCDGHEDCNNGADEQGCPTRTCPEDEFHCQDGRC
ISQQFLCDGDRDCLDGSDEVTCSVTTCGPANFQCNSSACIPQLWACDGDSDCSDGSDEWP
QRCEGRDTDGSDEWPQRCEGRDTSAAQGANGPCSSLEFHCRSGECIHSSWHCDGAHDCKD
KSDEEDCGEACDGSDEWPQRCEGRDTSAAQGANGPCSSLEFHCRSGECIHSSWHCDGAHD
CKDKSDEEDCVVATCRPDEFQCADGTCIHGSRQCDQEHDCRDQSDEVGCINVTLCEGPNK
FKCHSGECITLDKVCNAARDCRDWSDEPLKECGTNECLDNNGGCSHICKDLKIGYQCLCP
SGFHLADQWQCKGSVAYLFFTNRHEVRKMTPDRSQYASLLSNLKYAVALDAEVASSRLYW
SDLSHRKIYSTRISAAPGSAHDTVIDGDLQAPDGLAVDWVHRNIYWTDSVPGTVSVADTR
GVKRRTLFQRKGSKPRGIVVDPVHGFMYWTDWGTPAKIEKGGLNGVDMYSLVTEDIEWPN
GITLDLSSSRLYWVDSKLHSIFSIDVNGRNRKTILEDEKQLAHPFSLAIFEDKIFWTDII
NEAIFSVNRLTGLDVHLVAENLSSPEDIVLFHNVTQPKGVNWCERTALPNGGCQYLCLPA
PQINSHSPKFTCVCPDGMVLAKDMRSCLTEAEPSVTTPVHPTARPEASSTAVRPKHADQW
PAPSTSGRPVATSGLTTAASVTMSHQVVGNAAGRGEKPHSVGALTIVLPIGLVALLCLGA
FLLWKNWRLKNINSINFDNPVYQKTTEDEVHICRSQDGYIYPSRQRVSLEDDVV
Download sequence
Identical sequences G5BUI5
HGL_H00000252444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]