SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000253778-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000253778-2
Domain Number 1 Region: 706-1058
Classification Level Classification E-value
Superfamily SIS domain 5.94e-74
Family double-SIS domain 0.00000429
Further Details:      
 
Domain Number 2 Region: 366-572,613-657
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 4.37e-53
Family Class II glutamine amidotransferases 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000253778-2
Sequence length 1110
Comment GFPT2 (Homo_sapiens) glutamine-fructose-6-phosphate transaminase 2
Sequence
MDHVPRARTEGQAEQAGTFLMATLLQDPIGGASAPRAPRSFHSSDRTFGPCPDCQSHLPP
ALPASPEGEVLRASAESHSAMKLATAFLVLCLALLSHFGDAFFVESLPKPVAEPIAALAP
AAGAVAGAMPSLPLPFNPLKFMLASLGIPVEHLIEGSRKCVTELGPEAVGAVKTLLKTHY
TAREETENACAPIPVTKAAQAAAGRTNQCLEEHGHHLEHRLPLERPKKTHYTAREETENA
CAPIPVTKAAQAAAGRTNQCLEEHGHHLEHRLPLERPKVVSVRPKCGVLNSTQLVPRGCD
QQLLRHTAASCRVRPPGSSLRELAVLSSVVWVSPEFQGPLGPLILSSWVVSPAWHRLLKP
QAPRRGIFAYMNYRVPRTRREIFETLIKGLQRLEYRGYDSAGVAIDGNNHEVKERHIQLV
KKKGKVKALDEELYKQESMDLKVEFETHFGIAHTRWATHGVPSAVNSHPQRSDKGNEFVV
IHNGIITNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQ
LEGAFALVFKSLHYPGEAVATRRGSPLLIGVRSKYKLSSKQIPVLYRTCNVENVKNICKK
RMKRLDSSTCLHAVGDKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKR
SASDDPSRAIQTLQMELQQIMKGRILFPHFTVLCTALSQVADVREGNFSAFMQKEIFEQP
ESVFNTMRGRVNFETNTVLLGGLKDHLKEIRRCRRLIVIGCGTSYHAAVATRQVLEELTE
LPVMVELASDFLDRNTPVFRDDVCFFISQSGETADTLLALRYCRDRRALTVGVTNTVGSS
ISRETDCGVHINAARRSAWPAPSQFISLVMFGLMMSEDRISLQNRRQEIIRGLRSLPELI
REVLSLEEKIHDLALELYLLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLA
LVDKQIPGSIVIMKNARTLCSKSQPARRPEPSSSILGWLMKLQGRPIILCCKDDTESSKF
AYKTIELPHTVDCLQGILSVIPLQLLSFHLAVLRGYDTRPFLGKLWARPPEDPGDTGLSM
AGHLAGLRLEQGLGRNRNTARERLLCALCF
Download sequence
Identical sequences G5C7A5
HGL_H00000253778-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]