SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000261336-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000261336-2
Domain Number 1 Region: 739-1017
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 3.84e-68
Family Complement components 0.00013
Further Details:      
 
Domain Number 2 Region: 595-715
Classification Level Classification E-value
Superfamily E set domains 1.23e-32
Family SVA-like 0.012
Further Details:      
 
Domain Number 3 Region: 1091-1167
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 0.00000000000000144
Family Alpha-macroglobulin receptor domain 0.000049
Further Details:      
 
Weak hits

Sequence:  HGL_H00000261336-2
Domain Number - Region: 242-314
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00102
Family Invasin/intimin cell-adhesion fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000261336-2
Sequence length 1218
Comment PZP (Homo_sapiens) pregnancy-zone protein
Sequence
MEDFWPLHGPYLRQYMVLVPSWLHTEVPEKSCLHLCHLNETVTVSASLESSVGNRSLFSD
LVIDKDLFQCVSFTIKGPTHVFRDRMAVLVKNRESAVIVQTDKPMYTPGQSVLPNFDVQV
KCPKTVSFLDKEVNVTVCGIYTYGKPVRGHVKLNICRKYLVDYFFGPLYVYFSGTGTGCE
EISQELDSQGCITQPVMTYVDLVDWQLAQVAVLQLNAKIIEEGTGLEFTRTGTTEVNKVR
INLVLVQKDFYFRQGIPFVVQVHLEDRKGVPIANEHVFLQVYARNSYTTNATTDEHGLVE
FSINTTDIKLFSFTFKIMAKGSIIQTRTHAFLIEPGELQGHFNLSIPMEPYMAPVSQMLI
YAILPKGEVIADSTKFKIVNCPLSKVGLSFSSAQTLPASQAHLQVTAAPQSLCALRAAVD
QSVLLLRPEAELSASSIYNLLSMMDNDFIPCLNHVANDPENCQNDEHGNFDKISYSQLCK
FAKDAFGYIESMGLNTFTNLKIRNPRLCLDNTLSPIAVPVMLSHNEILVEGSEKPFTKSV
RNYFPETWIWDLIVVNSSGVAEVGVTVPDTITEWKAGAFCLSSDSRLGLSPTASLRAFQS
FFVEFTMPYSVVRGEAFTLKATVVNYLPDCIRVSVQLAASPDFTAVPVEKDQDSYCLCAD
GRQTVSWLVTPKLLGNVNFSVSAETRQSPELCGNGVATVPEAGRKDTVVKGLLVEPEGIK
KEYKFNSFLCASGDILSSSIKNIQNLLQMPYGCGEQNMVLFTPNIYILKYLNETHQLTQK
IKSKAISYLYSGYQRELNYKHPDGSYSAFGHQDYKNEGNIAFVLKTFVQARAFIFINETH
ITHALSWLFQKQKDSGCFRSSGRLFHNDLKGEVEDEVTLSAYITIALLEIPLPPTHPIVS
KALICLNSTWETTKEVTNGSHVYTKALLAYAFALAGNQEKKKEILKSIDEEAVKEGEEDN
SVHWERPQKPREPERYLYQPQAPSAEVEMTAYVLLAHLTAQPDTVVALHALSRYGAATFS
RTGKMSSVTIQSSGTFSTKFQVENSNCPLLQQVTLPNIPGEYNINVSGEGCVYTQTALKY
NALLEKEDSGFALEVQTIPQTCDGPEAHMSFQISLEFRKEVNNSNVLIYVDQVTNQTLSF
AFTVVQDVPVRNLKPALVKVYDYYETAQVNNLQPLSSTCTLLSKPVFPNAKLSAAFMVAV
GFLTLHDNTETHTWGAER
Download sequence
Identical sequences G5BPM0
HGL_H00000261336-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]