SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000265348 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000265348
Domain Number 1 Region: 1195-1299,1351-1497
Classification Level Classification E-value
Superfamily Cullin homology domain 2.62e-38
Family Cullin homology domain 0.002
Further Details:      
 
Domain Number 2 Region: 798-954
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.37e-35
Family APC10-like 0.01
Further Details:      
 
Domain Number 3 Region: 357-430
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.86e-30
Family CPH domain 0.00000888
Further Details:      
 
Domain Number 4 Region: 115-200,651-765
Classification Level Classification E-value
Superfamily ARM repeat 0.000000198
Family RPA1889-like 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000265348
Sequence length 1676
Comment CUL7 (Homo_sapiens) cullin 7
Sequence
MVGELRYREFRVPLGPGLHAYPDELIRQRVGHDGHPEYQIRWLILRRGEDGEGAPGQVDC
KAEHILLWMSDDEIYANCHKMLGEDGQVIRPSQKSAAEAGTLDKSVLGEMETDVKSLIQR
ALRQLKECVGTVPPAPLLHTVHVLSAYASIEPLTGVFKDPRVLDLLMHMLSSPDYQIRWS
AGRMIQALSSHDAGTRTHILLSLSQQEAIEKHLDFDSRCALLALFAQATLAEHPMSFEGI
QLPQVPGRLLFSLVKRYLHATFLLDQLNSSAQESGAPAELTEEKGRLDLEFSMAMGTLIS
ELVQAMHWDWASSRPGSSARSPCSIFQPQPADASRRLPPSQARHSFRRRSRQFRARMEFA
SGNTYALYVRDMLQPGMRVRMLDDYEEISAGDEGEFRQSNSGVPPAQVWWESTGRTYWVH
WHMLEILGFEEDVEDVVEAANHQGAVVSGALGGVLPSWRWKPMTELYAVPYVLPEDEDTE
ESEHLSQAEWWELLFFIRKLDGPDHQEVLQMVQENLDREHVLDDEILSELAVPVELACNL
LESLPQRLNDSALRDLLNCRVYRKYGPEAPAGQPACPPLLQAQGQEDATRAEEKKPHSQS
PGAALRHLAEGLGPAGQLLVDLERALGCAGPQDGEVRPCLLQLQRQPQPFLALLRSLDTP
ATNKALHLAALRILTKLVDFPEALLLPWHEAMDACVACLKSPNTDCEVLQKLIVFLHRLT
SGSRDNAVVLNQLGAQDAISKALEKHPGKLESAPELRDAVSKCKKHTHLYRNLTTNILGG
CIQMVLGQIEDHRRTHRPINIPFFDAFLRYLCQGSSVDVKEGKCWEKVEVSSNPHRASKL
TDRNPKTYWESSGSTGSHHITLHMHQGVLIRQLTLLVAREDASYMPALVAVYGGNTTSSL
NTELNSVNVMPCASRVTLLENLTHFWPILQIRIKRCQQGGIDTRIRGVEVLGPKPTFWPA
FREQLCRHTRLFYVVRAQAWSQDIAEDRRSLLHLSSRLNGALRHEQNFADRFLPDEEASR
ALGKTCWEALVSPLVQNITSPDEDGVSALGWLLNQYLECREAAHNPQSRAAAFSSRVRRL
THLLVHVEPCEPAAAPRPKGGSGSHDWGSPTTWGLPGSILRNLTCCWRAVVEEQVNAFLT
SHWRDDDFVQRYCERFYNLQKSSSELFGPRAAFLLALQSGCAGALLQLPFLRAAHVSEQF
ARHIDQRIQGSRVGGAQGMETLVQLQRSLEAALVFSGLEVATTFEHYYQHYMADRLLNLG
SSWLEGAVLEQIGLCFPNRLPQLMLRSLRTSEELQRQFHVYQLQRLDEELLKLEDTERKL
QVGRETSGQEPEHEQEEDTRAAATAAIAEDEEEENEDLYYEGMMPKVSVLVLSPRCWPVT
SICHTLNPKTWLPSYLRGTLNRYSNFYHKSQTQPAPEGGPHRRLQWTWLGRAEVQFGDQT
LHVSTVQMWLLLNFNSLKVVSVESLLVHSGLPPHLLHRAIGPLTSTRGPLDLREQDNIPG
GVLKIRDDDEEPRPRWGSVWLIPPQTYLEAEDEEGHSLEKRRNLLNCLVVRMLKPHGDEG
LHIDRLVCLVLEAWQKGPCPPQGLISSLGRGATCSSTDVLSSILHLLSKGTLRRHDTRLQ
VLCYAVPVTVVEPHTESLSPGSSGPNPPLTFHTLQIRSRGVPYASCTDTHSFSTFR
Download sequence
Identical sequences G5BNL3
HGL_H00000265348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]