SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000270279 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000270279
Domain Number 1 Region: 193-279
Classification Level Classification E-value
Superfamily SH2 domain 1.65e-43
Family SH2 domain 0.0000167
Further Details:      
 
Domain Number 2 Region: 107-191
Classification Level Classification E-value
Superfamily EF-hand 4.44e-39
Family EF-hand modules in multidomain proteins 0.0002
Further Details:      
 
Domain Number 3 Region: 285-362
Classification Level Classification E-value
Superfamily RING/U-box 4.57e-37
Family RING finger domain, C3HC4 0.00015
Further Details:      
 
Domain Number 4 Region: 2-106
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 4.05e-32
Family N-terminal domain of cbl (N-cbl) 0.00059
Further Details:      
 
Weak hits

Sequence:  HGL_H00000270279
Domain Number - Region: 392-416
Classification Level Classification E-value
Superfamily RING/U-box 0.000247
Family RING finger domain, C3HC4 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000270279
Sequence length 512
Comment CBLC (Homo_sapiens) Cas-Br-M (murine) ecotropic retroviral transforming sequence c
Sequence
MGPPSLQDLLPGTAQLLREVAKAQRDAGPEGPGGAWDFLHVYLANLEAKGRQVAAFLPAR
GRRGVNEELFREGSMLRRQLAKLALIFSHMHAELGALFPGGRYCGHRYQLTKTAAHAFWR
EHCGARCVLPWAEFQSLLSTCHPVEPGATAQALRSTIDLTCSGHISIFEFDIFTRLFQPW
PTLLKNWQLLAINHPGYMAFLTYDEVQVRLQACRDKPGSYIFRPSCTRLGQWAIGYVSTD
GSILQTIPPNRPLLQVLLEGQKDGSFCYPDGKNRNPDLTELCQAEPHQRIHVSKEQLQLY
WAMDSTFELCKICAERDKDVKIEPCGHLLCSHCLAAWQNEDSQICPFCRCEIKDREAVSI
YQLSGDTAEGGATAVDTDDSSDQENVELELEQNEDSQICPFCRCEIKDREAVSIYQLSGD
TAEGGATAVDTDDSSDQENVELELEQVAPSAPPLPPRLDLPPRRPRSECQLEAAPLALPR
LRGPFPLPRIRTVASAMWNATSRAQATEGATE
Download sequence
Identical sequences G5CBN1
HGL_H00000270279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]