SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000275560-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000275560-2
Domain Number 1 Region: 57-165
Classification Level Classification E-value
Superfamily SRCR-like 3.01e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 2 Region: 190-292
Classification Level Classification E-value
Superfamily SRCR-like 3.92e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 3 Region: 470-572
Classification Level Classification E-value
Superfamily SRCR-like 4.97e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 4 Region: 354-445
Classification Level Classification E-value
Superfamily SRCR-like 1.1e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000275560-2
Sequence length 574
Comment SRCRB4D (Homo_sapiens) scavenger receptor cysteine rich domain containing, group B (4 domains)
Sequence
VHKEAEMRIRILGSQPDEMSRGWRLGDGGAAHTPLPPALSFLLLLPLASALQPTLLPLPE
LRLVGGLSRCRGRLEVLHGGSWGSVCDDDWDVVDANVVCRQLGCGLALPVPRPLAFGQGR
GPILLDNVECLGQEAALSECGSRGWGIHNCFHYEDVAVLCDEFLPTQLPTRRMLTSRAPP
TTPQNGKGEGSVRLVGGAGPCQGRVEILHGGLWGTVCDDDWGLPDAAVVCRQLGCGAALA
ATTNAFFGYGTGHILLDNVHCEGGEPRLAACLSLGWGVHNCGHHEDAGALCAVLGPPTLT
ALPPSATREDGSWHTEPAATGVGAQPSGETAQFTTAAWAAGKKSKWQSQGPAWGGSGVLY
AGGWGTVCDDDWDFADARVACREAGCGPALGATGLGHFGYGRGPILLDNVGCVGTEARLS
DCFHLGWGQHNCGHHEDAGALCAGPEELGSQVHQDGSETTRVPTPRPRDGHLRLASGAHR
CQGRVELFLGQRWGTICDDAWDLRAARVLCRQLGCGQALAAPGEAHFGPGRGPILLDNVK
CHGDESTLLLCSHIRWDAHNCDHSEDASVLCQLS
Download sequence
Identical sequences G5AXC6
HGL_H00000275560-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]