SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000286744 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000286744
Domain Number 1 Region: 1308-1387
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-17
Family I set domains 0.013
Further Details:      
 
Domain Number 2 Region: 924-997
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000533
Family I set domains 0.068
Further Details:      
 
Domain Number 3 Region: 707-760
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000288
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 4 Region: 1208-1286
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000455
Family I set domains 0.026
Further Details:      
 
Domain Number 5 Region: 419-479
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000798
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 6 Region: 571-625
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000811
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 7 Region: 474-534
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000327
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 8 Region: 815-881
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 9 Region: 74-123
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 10 Region: 763-820
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000968
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 11 Region: 1482-1544
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000196
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 12 Region: 1603-1658
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000129
Family TSP-1 type 1 repeat 0.0065
Further Details:      
 
Domain Number 13 Region: 647-704
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000432
Family TSP-1 type 1 repeat 0.0069
Further Details:      
 
Domain Number 14 Region: 341-401
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000051
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 15 Region: 1426-1483
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000131
Family TSP-1 type 1 repeat 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000286744
Sequence length 1694
Comment ADAMTSL3 (Homo_sapiens) ADAMTS-like 3
Sequence
MASWKSPWWLLVWMVFTHSALLQTTSEKSPGAYFLPEFALSPQGSFLEDTTGEQFLTYRY
DDQTSRNARSEEDRDGNWDAWGDWSDCSRTCGGGASYSLRRCLTGRNCEGQNIRYKTCSH
HDCPPDAEDFRAQQCSAYNDVQYQGHYYEWLPRYNDPTAPCALKCHARGQNLVVELAPKV
LDGTRCNADSLDMCISGVCQAVGCDRQLGSVAKEDSCGVCAGDGSTCRLVRGQSKSHVSP
EKKEENVIAVPLGSRSVRITVKGPAHLFIESKTLQGSKGEHSFNSPGIFVVENTTVEFQK
GSERQTFKIPGPLMADFIFKTRYTMAKDSVVQFFFYQPISHQWRQTDFFPCTVTCGGGYQ
LNSAECVDIRLKRVVPDHYCHYYPENVKPKPKLKECGMDPCPSSDGFKEIMPYDHFQPLP
RWEHNPWTACSVSCGGGIQRRSFVCVEESMHSEILQVAEWKCMYAPKPKVMQTCNLFDCP
KWVAMEWSQCTVTCGRGLRYRVVLCISHLGEHVGGCNPQLKLHIKEECVIPTPCYKPKEK
SPVEAKLPWLKQAQELEETRIATEEPTFIPEPWSACSSTCGPGVQMRAVRCRVLLAFART
EAELPEEECEGPQPPTERPCLLQACPGSPAPRKPDSSGLQEDSMGTYAWEYAGFTSCTAT
CLGGHQEAIAVCLHTQTQQMVNNSLCDAVHRPPAMSQACNTEPCPPRWQVGSWGPCSASC
GVGIQTREVHCLHPAESPAPPEKCGHGKPHALQACNQFDCPPAWHIEEWQQCTRTCGGGT
QNRRVTCRQLLTDGSFLNLPDELCQGPQASSRKSCARIDCPPHLAAGDWSKCSVSCGIGL
QRRKQVCQRLTAKGGRIMLSEVMCRYLPALPLIRPCQMPVCGEMKLETKTKAAEPGPQIL
SVQRVYIQTRVEKRINLTIGSRAYLLPNTSVIIKCPVRRFQRSLIRWEKDGQCLQNSKRL
SITKSGSLKIHSLEAPDIGVYGCIAGSAQDTVVLKLIGTDNRLIAHPALRQHGREHPRMD
HPEANSLGATWQKMWQMWSNKNELYLPDGQINNQPFFRALFGHCSNPAGNTNSWEFKNKQ
FEAAVKQGAYSMDTVQFEELIRNMSQLMETGEVSEDFASQVIYQLVAELVKVQPMPPQWR
GTQEELQPSAQLTDQTGSAPQSGSVESAGKLTFKPKGPVLVRQSQPPSVSFNKTITARIG
NTVYITKRTEVINIVCDLVSPSEVTYTWTKDGALLQPSVKISLDGAGRIQIRNPARKEQG
LYECSVANHLGSDVESSSVLHAEAPVILSIERNITKPEHNHLSVVVGGTIEAAIGANVTI
RCPVKGVPQPNVTWLKRGRSLSDNVSLLFNGSLLLQNVSFENEGTYICTGTNALGKVVAA
STLHLLERRWPGSKIVLPKGHKKRVLQASNTRTSSSNAREPVPQEPFWEPGNWTHCSATC
GHLGARIQRPRCVTASRQEVSSALCDHLQKPRAGFQPCKILDCPARWFTSVWSECSVSCG
EGFHSRQVTCKQTKASGTVQVVSPKACDPKDRPLGRKPCSGYPCAQWVIEPDHQCPGRCL
GRMVRTQQHHHAACGHHNSSDSSCEDRRPALWRNCTSGACEVCWRTGPWRPCTAACGRGF
QSRKVDCVHMRSCKPVPDGHCVQRKKPTSWRHCHGPSCERDCTDTTHYCTFVKHLNLCSL
DLHKQRCCHSCQEG
Download sequence
Identical sequences G5BEZ9
HGL_H00000286744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]