SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000297350 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000297350
Domain Number 1 Region: 236-315
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000774
Family DEATH domain, DD 0.013
Further Details:      
 
Domain Number 2 Region: 64-112
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000153
Family TNF receptor-like 0.0051
Further Details:      
 
Domain Number 3 Region: 132-189
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000639
Family TNF receptor-like 0.0028
Further Details:      
 
Domain Number 4 Region: 322-400
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000733
Family DEATH domain, DD 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000297350
Sequence length 430
Comment TNFRSF11B (Homo_sapiens) tumor necrosis factor receptor superfamily, member 11b
Sequence
MCKQSLGDNLQVPTHEVHEDFRPPVQCRRDQIQLPKRQQFLDISIQWTTQETVPPKYLHH
DPETSRQLMCDKCPPGTYLKQHCTARRKTVCAPCPDHSYTDSWHNSDECLYCSPVCKELQ
FVKQECNRTHNRVCECEEGRYLELEFCLKHRSCPPGLGVLQAGTPERNTVCARCSDGFFS
DETSSKAPCRKHTNCSVLGLLLTQKGNATSDSICSGNSETTPKCGIDVTLCEEALFRFAV
PPKFTPNWLSVLVDNLPGIKVNTESIERIKRRHNSQEQTFQLLKLWKQQNKDQDMVKRII
QDIDLCENGVQRHIGHANLTFEQLRSLMESLPGKKVGIEDIERTRKTCKSTEQFLKLLSL
WRIRNGDQDTLKGLMHALKHLKMYHFPKTVTHSLRKTIRFLHSFTMYRLYQKLFLEMIGN
QVQSVKISCL
Download sequence
Identical sequences G5C9R9
HGL_H00000297350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]