SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000304668 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000304668
Domain Number 1 Region: 57-253,313-446
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.78e-62
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00024
Further Details:      
 
Domain Number 2 Region: 459-552
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 2.45e-19
Family Anticodon-binding domain of Class II aaRS 0.0037
Further Details:      
 
Domain Number 3 Region: 5-58
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.0000000000337
Family a tRNA synthase domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000304668
Sequence length 561
Comment HARS (Homo_sapiens) histidyl-tRNA synthetase
Sequence
MANRASLEELVRLQGERVRSLKQQKANAEQVEEEVAKLLKLKAQLGSDESKQKFVLKTPK
GTRDYSPRQMAVREKVFDAIIHCFKRHGAEVIDTPVFELKETLTGKYGEDSKLIYDLKDQ
GGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAG
QFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVPDNKFRTICSSVDK
LDKVSWEDVKNEMVGEKGLAPEVADHIGDYVQQHGGVSLVEQLLQDPKLSQNKQAMEGLL
DVKLLFEYLTLFGIADKISFDLSLARGGVSLVEQLLQDPKLSQNKQAMEGLLDVKLLFEY
LTLFGIADKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGEEPLGVGSVAAGGRYDGLVG
MFDPKGRKVPCVGLSIGVERIFSIVEQRLEASEEKVRTTETQVLVASAQKKLLEERLKLV
SELWNAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDRVIKLRSVATREEVD
VRREDLVEEIRRRTSQPLCIS
Download sequence
Identical sequences G5AR53
HGL_H00000304668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]