SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000305682 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000305682
Domain Number 1 Region: 136-313
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 9.94e-24
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0057
Further Details:      
 
Domain Number 2 Region: 86-130
Classification Level Classification E-value
Superfamily TGS-like 0.0000621
Family TGS domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000305682
Sequence length 323
Comment MRPL39 (Homo_sapiens) mitochondrial ribosomal protein L39
Sequence
IEAMASAVRGLRLWLVAPSGGVSRRFIASSPAAQLSLTELTEMRNDLFNKEKKRQLSLTP
RTEKIEVKHVGKTDPGTVFVMNKNISTPYSCAMHLSEWYCRKSILALVDGQPWDMYKPLT
KSCEIKFLTFKDCNPTEVNKAYWRSCAMMVGCVIERAFKDEYVVTLLRAPEVPVIAGAFC
YDVVLDKRLDEWIPTKENLRSLTKDAHGLIYKDLPFETLEVEAKVALEIFQHNKYKIDFI
EEKASQNPERTVKLHRIGDFIDVSEGPLIPRTSICFQYEVSAVHNLQPTQPCLVRRFQGL
SLPVHLKAHFTVWDKLLERSRKM
Download sequence
Identical sequences G5AM84
HGL_H00000305682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]